Recombinant Full Length Human HTR3B Protein
Cat.No. : | HTR3B-5693HF |
Product Overview : | Human HTR3B full-length ORF (NP_006019.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 172 amino acids |
Description : | The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | HTR3B 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic [ Homo sapiens ] |
Official Symbol | HTR3B |
Synonyms | HTR3B; 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3B; 5-hydroxytryptamine receptor 3B; 5 HT3B; 5-HT3-B; serotonin-gated ion channel subunit; 5-hydroxytryptamine 3 receptor B subunit; 5-HT3B; |
Gene ID | 9177 |
mRNA Refseq | NM_006028 |
Protein Refseq | NP_006019 |
MIM | 604654 |
UniProt ID | O95264 |
◆ Recombinant Proteins | ||
RFL5589RF | Recombinant Full Length Rat 5-Hydroxytryptamine Receptor 3B(Htr3B) Protein, His-Tagged | +Inquiry |
RFL1854MF | Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 3B(Htr3B) Protein, His-Tagged | +Inquiry |
HTR3B-5693HF | Recombinant Full Length Human HTR3B Protein | +Inquiry |
HTR3B-2966R | Recombinant Rat HTR3B Protein | +Inquiry |
HTR3B-4377M | Recombinant Mouse HTR3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR3B-828HCL | Recombinant Human HTR3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR3B Products
Required fields are marked with *
My Review for All HTR3B Products
Required fields are marked with *