Recombinant Full Length Human ICAM1 Protein, C-Flag-tagged
Cat.No. : | ICAM1-1179HFL |
Product Overview : | Recombinant Full Length Human ICAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.2 kDa |
AA Sequence : | MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYEIVIITVVAAA VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis |
Full Length : | Full L. |
Gene Name | ICAM1 intercellular adhesion molecule 1 [ Homo sapiens (human) ] |
Official Symbol | ICAM1 |
Synonyms | BB2; CD54; P3.58 |
Gene ID | 3383 |
mRNA Refseq | NM_000201.3 |
Protein Refseq | NP_000192.2 |
MIM | 147840 |
UniProt ID | P05362 |
◆ Cell & Tissue Lysates | ||
ICAM1-1970RCL | Recombinant Rat ICAM1 cell lysate | +Inquiry |
ICAM1-2487MCL | Recombinant Mouse ICAM1 cell lysate | +Inquiry |
ICAM1-2655HCL | Recombinant Human ICAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICAM1 Products
Required fields are marked with *
My Review for All ICAM1 Products
Required fields are marked with *