Recombinant Full Length Human ID4 Protein
| Cat.No. : | ID4-248HF |
| Product Overview : | Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 161 amino acids |
| Description : | Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al. |
| Form : | Liquid |
| Molecular Mass : | 43.780kDa inclusive of tags |
| AA Sequence : | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ] |
| Official Symbol | ID4 |
| Synonyms | ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27 |
| Gene ID | 3400 |
| mRNA Refseq | NM_001546 |
| Protein Refseq | NP_001537 |
| MIM | 600581 |
| UniProt ID | P47928 |
| ◆ Recombinant Proteins | ||
| ID4-248HF | Recombinant Full Length Human ID4 Protein | +Inquiry |
| ID4-28078TH | Recombinant Human ID4 | +Inquiry |
| ID4-2189R | Recombinant Rhesus monkey ID4 Protein, His-tagged | +Inquiry |
| ID4-4408M | Recombinant Mouse ID4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ID4-992H | Recombinant Human ID4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ID4-5309HCL | Recombinant Human ID4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ID4 Products
Required fields are marked with *
My Review for All ID4 Products
Required fields are marked with *



