Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged
Cat.No. : | IGFL1-416HFL |
Product Overview : | Recombinant Full Length Human IGFL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12.2 kDa |
AA Sequence : | MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | IGFL1 IGF like family member 1 [ Homo sapiens (human) ] |
Official Symbol | IGFL1 |
Synonyms | UNQ644; APRG644 |
Gene ID | 374918 |
mRNA Refseq | NM_198541.2 |
Protein Refseq | NP_940943.1 |
MIM | 610544 |
UniProt ID | Q6UW32 |
◆ Recombinant Proteins | ||
IGFL1-8753H | Recombinant Human IGFL1 protein, mFc-tagged | +Inquiry |
IGFL1-416HFL | Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged | +Inquiry |
IGFL1-2627H | Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged | +Inquiry |
IGFL1-502H | Recombinant Human IGFL1 Protein, MYC/DDK-tagged | +Inquiry |
IGFL1-1160H | Recombinant Human IGFL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFL1-5263HCL | Recombinant Human IGFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFL1 Products
Required fields are marked with *
My Review for All IGFL1 Products
Required fields are marked with *