Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged

Cat.No. : IGFL1-416HFL
Product Overview : Recombinant Full Length Human IGFL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 12.2 kDa
AA Sequence : MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG
NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein, Transmembrane
Full Length : Full L.
Gene Name IGFL1 IGF like family member 1 [ Homo sapiens (human) ]
Official Symbol IGFL1
Synonyms UNQ644; APRG644
Gene ID 374918
mRNA Refseq NM_198541.2
Protein Refseq NP_940943.1
MIM 610544
UniProt ID Q6UW32

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFL1 Products

Required fields are marked with *

My Review for All IGFL1 Products

Required fields are marked with *

0
cart-icon