Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged
| Cat.No. : | IGFL1-2627H |
| Product Overview : | Recombinant Human IGFL1 Protein (25-110 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | E.coli |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 25-110 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 16.8 kDa |
| AA Sequence : | APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | IGFL1 IGF-like family member 1 [ Homo sapiens ] |
| Official Symbol | IGFL1 |
| Synonyms | UNQ644; APRG644; |
| Gene ID | 374918 |
| mRNA Refseq | NM_198541.1 |
| Protein Refseq | NP_940943.1 |
| MIM | 610544 |
| UniProt ID | Q6UW32 |
| ◆ Recombinant Proteins | ||
| IGFL1-3439H | Recombinant Human IGFL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IGFL1-502H | Recombinant Human IGFL1 Protein, MYC/DDK-tagged | +Inquiry |
| IGFL1-8753H | Recombinant Human IGFL1 protein, mFc-tagged | +Inquiry |
| IGFL1-2627H | Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged | +Inquiry |
| IGFL1-416HFL | Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGFL1-5263HCL | Recombinant Human IGFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFL1 Products
Required fields are marked with *
My Review for All IGFL1 Products
Required fields are marked with *
