Recombinant Human IGFL1 protein, mFc-tagged

• Cat.No.: IGFL1-8753H
• Product Overview: Recombinant Human IGFL1 protein(Q6UW32)(25-110aa), fused with C-terminal mFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: mFc
• Protein Length: 25-110aa
• Tag: C-mFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Gene Information

• Gene Name: IGFL1 IGF-like family member 1 [ Homo sapiens ]
• Official Symbol: IGFL1
• Synonyms: UNQ644; APRG644
• Gene ID: 374918
• mRNA Refseq: NM_198541.1
• Protein Refseq: NP_940943.1
• MIM: 610544
• UniProt ID: Q6UW32