Recombinant Full Length Human ING1 Protein, GST-tagged

Cat.No. : ING1-5873HF
Product Overview : Human ING1 full-length ORF ( NP_937862.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 279 amino acids
Description : This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Molecular Mass : 58.3 kDa
AA Sequence : MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ING1 inhibitor of growth family, member 1 [ Homo sapiens ]
Official Symbol ING1
Synonyms ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1;
Gene ID 3621
mRNA Refseq NM_005537
Protein Refseq NP_005528
MIM 601566
UniProt ID Q9UK53

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ING1 Products

Required fields are marked with *

My Review for All ING1 Products

Required fields are marked with *

0
cart-icon