Recombinant Full Length Human ING1 Protein, GST-tagged
| Cat.No. : | ING1-5873HF |
| Product Overview : | Human ING1 full-length ORF ( NP_937862.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 279 amino acids |
| Description : | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
| Molecular Mass : | 58.3 kDa |
| AA Sequence : | MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ING1 inhibitor of growth family, member 1 [ Homo sapiens ] |
| Official Symbol | ING1 |
| Synonyms | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1; |
| Gene ID | 3621 |
| mRNA Refseq | NM_005537 |
| Protein Refseq | NP_005528 |
| MIM | 601566 |
| UniProt ID | Q9UK53 |
| ◆ Recombinant Proteins | ||
| ING1-5132H | Recombinant Human ING1 Protein, GST-tagged | +Inquiry |
| ING1-28775TH | Recombinant Human ING1 | +Inquiry |
| ING1-8207M | Recombinant Mouse ING1 Protein | +Inquiry |
| ING1-721H | Recombinant Human ING1 Protein, His-tagged | +Inquiry |
| ING1-2405H | Recombinant Human ING1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING1 Products
Required fields are marked with *
My Review for All ING1 Products
Required fields are marked with *
