Recombinant Full Length Human INO80E Protein, C-Myc/DDK-tagged
| Cat.No. : | INO80E-12HFL |
| Product Overview : | Recombinant Full Length protein of human INO80 complex subunit E (INO80E) with a C-Myc/DDK tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 μg/mL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Full Length : | Full L. |
| Gene Name | INO80E INO80 complex subunit E [ Homo sapiens (human) ] |
| Official Symbol | INO80E |
| Synonyms | INO80E; INO80 complex subunit E; CCDC95; INO80 complex subunit E; coiled-coil domain containing 95; coiled-coil domain-containing protein 95 |
| Gene ID | 283899 |
| mRNA Refseq | NM_173618.1 |
| Protein Refseq | NP_775889.1 |
| UniProt ID | Q8NBZ0 |
| ◆ Recombinant Proteins | ||
| INO80E-5113H | Recombinant Human INO80E Protein, GST-tagged | +Inquiry |
| INO80E-3547H | Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| INO80E-3070R | Recombinant Rat INO80E Protein | +Inquiry |
| INO80E-2095R | Recombinant Rhesus Macaque INO80E Protein, His (Fc)-Avi-tagged | +Inquiry |
| INO80E-11668Z | Recombinant Zebrafish INO80E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INO80E-5201HCL | Recombinant Human INO80E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INO80E Products
Required fields are marked with *
My Review for All INO80E Products
Required fields are marked with *
