Recombinant Human INO80E Protein, GST-tagged
Cat.No. : | INO80E-5113H |
Product Overview : | Human INO80E full-length ORF ( NP_775889.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | INO80E (INO80 Complex Subunit E) is a Protein Coding gene. Among its related pathways are Deubiquitination and Transcription-Coupled Nucleotide Excision Repair (TC-NER). |
Molecular Mass : | 52.9 kDa |
AA Sequence : | MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INO80E INO80 complex subunit E [ Homo sapiens ] |
Official Symbol | INO80E |
Synonyms | CCDC95; INO80E; INO80 complex subunit E |
Gene ID | 283899 |
mRNA Refseq | NM_173618 |
Protein Refseq | NP_775889 |
UniProt ID | Q8NBZ0 |
◆ Recombinant Proteins | ||
INO80E-5113H | Recombinant Human INO80E Protein, GST-tagged | +Inquiry |
INO80E-11668Z | Recombinant Zebrafish INO80E | +Inquiry |
INO80E-3547H | Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
INO80E-5893HF | Recombinant Full Length Human INO80E Protein, GST-tagged | +Inquiry |
INO80E-2726R | Recombinant Rat INO80E Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INO80E-5201HCL | Recombinant Human INO80E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INO80E Products
Required fields are marked with *
My Review for All INO80E Products
Required fields are marked with *
0
Inquiry Basket