Recombinant Human INO80E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : INO80E-3547H
Product Overview : INO80E MS Standard C13 and N15-labeled recombinant protein (NP_775889) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Molecular Mass : 26.5 kDa
AA Sequence : MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name INO80E INO80 complex subunit E [ Homo sapiens (human) ]
Official Symbol INO80E
Synonyms INO80E; INO80 complex subunit E; CCDC95; INO80 complex subunit E; coiled-coil domain containing 95; coiled-coil domain-containing protein 95
Gene ID 283899
mRNA Refseq NM_173618
Protein Refseq NP_775889
UniProt ID Q8NBZ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INO80E Products

Required fields are marked with *

My Review for All INO80E Products

Required fields are marked with *

0
cart-icon