Recombinant Full Length Human INO80E Protein, GST-tagged

Cat.No. : INO80E-5893HF
Product Overview : Human INO80E full-length ORF ( NP_775889.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 244 amino acids
Description : INO80E (INO80 Complex Subunit E) is a Protein Coding gene. Among its related pathways are Deubiquitination and Transcription-Coupled Nucleotide Excision Repair (TC-NER).
Molecular Mass : 52.9 kDa
AA Sequence : MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INO80E INO80 complex subunit E [ Homo sapiens ]
Official Symbol INO80E
Synonyms CCDC95; INO80E; INO80 complex subunit E
Gene ID 283899
mRNA Refseq NM_173618
Protein Refseq NP_775889
UniProt ID Q8NBZ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INO80E Products

Required fields are marked with *

My Review for All INO80E Products

Required fields are marked with *

0
cart-icon