Recombinant Full Length Human INPP4B Protein, GST-tagged
| Cat.No. : | INPP4B-5895HF |
| Product Overview : | Human INPP4B full-length ORF ( AAH05273, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 53 amino acids |
| Description : | INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq |
| Molecular Mass : | 31.57 kDa |
| AA Sequence : | MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INPP4B inositol polyphosphate-4-phosphatase, type II, 105kDa [ Homo sapiens ] |
| Official Symbol | INPP4B |
| Synonyms | INPP4B; inositol polyphosphate-4-phosphatase, type II, 105kDa; inositol polyphosphate 4 phosphatase, type II, 105kD; type II inositol 3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase type II; type II inositol-3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase II; 4-phosphatase II; MGC132014; |
| Gene ID | 8821 |
| mRNA Refseq | NM_001101669 |
| Protein Refseq | NP_001095139 |
| MIM | 607494 |
| UniProt ID | O15327 |
| ◆ Recombinant Proteins | ||
| INPP4B-5895HF | Recombinant Full Length Human INPP4B Protein, GST-tagged | +Inquiry |
| INPP4B-2728R | Recombinant Rat INPP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
| INPP4B-5109H | Recombinant Human INPP4B Protein, GST-tagged | +Inquiry |
| INPP4B-3072R | Recombinant Rat INPP4B Protein | +Inquiry |
| Inpp4b-3545M | Recombinant Mouse Inpp4b Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INPP4B Products
Required fields are marked with *
My Review for All INPP4B Products
Required fields are marked with *
