Recombinant Full Length Human Integrin Beta-8(Itgb8) Protein, His-Tagged
Cat.No. : | RFL24947HF |
Product Overview : | Recombinant Full Length Human Integrin beta-8(ITGB8) Protein (P26012) (43-769aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (43-769) |
Form : | Lyophilized powder |
AA Sequence : | EDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ITGB8 |
Synonyms | ITGB8; Integrin beta-8 |
UniProt ID | P26012 |
◆ Recombinant Proteins | ||
ITGB8-2317R | Recombinant Rhesus monkey ITGB8 Protein, His-tagged | +Inquiry |
ITGB8-255H | Recombinant Human ITGB8 Protein, His-tagged | +Inquiry |
RFL24947HF | Recombinant Full Length Human Integrin Beta-8(Itgb8) Protein, His-Tagged | +Inquiry |
ITGB8-4964H | Recombinant Human ITGB8 Protein, GST-tagged | +Inquiry |
ITGB8-2297R | Recombinant Rabbit ITGB8 Protein (146-384 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB8-881HCL | Recombinant Human ITGB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB8 Products
Required fields are marked with *
My Review for All ITGB8 Products
Required fields are marked with *
0
Inquiry Basket