Recombinant Full Length Human ISG20 Protein, C-Flag-tagged
Cat.No. : | ISG20-1682HFL |
Product Overview : | Recombinant Full Length Human ISG20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ISG20 interferon stimulated exonuclease gene 20 [ Homo sapiens (human) ] |
Official Symbol | ISG20 |
Synonyms | CD25; HEM45 |
Gene ID | 3669 |
mRNA Refseq | NM_002201.6 |
Protein Refseq | NP_002192.2 |
MIM | 604533 |
UniProt ID | Q96AZ6 |
◆ Recombinant Proteins | ||
ISG20-28642TH | Recombinant Human ISG20, His-tagged | +Inquiry |
ISG20-2128R | Recombinant Rhesus Macaque ISG20 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISG20-5753HF | Recombinant Full Length Human ISG20 Protein, GST-tagged | +Inquiry |
ISG20-1065H | Recombinant Human ISG20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ISG20-2600H | Recombinant Human ISG20 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG20-5151HCL | Recombinant Human ISG20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISG20 Products
Required fields are marked with *
My Review for All ISG20 Products
Required fields are marked with *
0
Inquiry Basket