Recombinant Full Length Human ISG20 Protein, C-Flag-tagged
| Cat.No. : | ISG20-1682HFL |
| Product Overview : | Recombinant Full Length Human ISG20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables 3'-5' exonuclease activity and RNA binding activity. Involved in defense response to virus; negative regulation of viral genome replication; and nucleobase-containing compound catabolic process. Located in cytoplasm and nuclear lumen. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20.2 kDa |
| AA Sequence : | MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | ISG20 interferon stimulated exonuclease gene 20 [ Homo sapiens (human) ] |
| Official Symbol | ISG20 |
| Synonyms | CD25; HEM45 |
| Gene ID | 3669 |
| mRNA Refseq | NM_002201.6 |
| Protein Refseq | NP_002192.2 |
| MIM | 604533 |
| UniProt ID | Q96AZ6 |
| ◆ Recombinant Proteins | ||
| ISG20-151H | Recombinant Human ISG20 Protein, His-tagged | +Inquiry |
| ISG20-1682HFL | Recombinant Full Length Human ISG20 Protein, C-Flag-tagged | +Inquiry |
| ISG20-5018H | Recombinant Human ISG20 Protein, GST-tagged | +Inquiry |
| ISG20-508H | Recombinant Human ISG20 protein, GST-tagged | +Inquiry |
| ISG20-1065H | Recombinant Human ISG20 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISG20-5151HCL | Recombinant Human ISG20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG20 Products
Required fields are marked with *
My Review for All ISG20 Products
Required fields are marked with *


