Recombinant Full Length Human ISG20L2 Protein, GST-tagged

Cat.No. : ISG20L2-5755HF
Product Overview : Human ISG20L2 full-length ORF (BAB14212.1, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 353 amino acids
Description : This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014]
Molecular Mass : 65.23 kDa
AA Sequence : MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ISG20L2 interferon stimulated exonuclease gene 20kDa-like 2 [ Homo sapiens ]
Official Symbol ISG20L2
Synonyms Interferon Stimulated Exonuclease Gene 20 Like 2; Interferon Stimulated Exonuclease Gene 20kDa-Like 2; Interferon Stimulated Exonuclease Gene 20kDa Like 2; Interferon-Stimulated 20 KDa Exonuclease-Like 2; EC 3.1.-.-; HSD38
Gene ID 81875
mRNA Refseq NM_030980
Protein Refseq NP_112242
MIM 611930
UniProt ID Q9H9L3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISG20L2 Products

Required fields are marked with *

My Review for All ISG20L2 Products

Required fields are marked with *

0
cart-icon
0
compare icon