Recombinant Full Length Human ISG20L2 Protein, GST-tagged

• Cat.No.: ISG20L2-5755HF
• Product Overview: Human ISG20L2 full-length ORF (BAB14212.1, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 353 amino acids
• Description: This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014]
• Molecular Mass: 65.23 kDa
• AA Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ISG20L2 interferon stimulated exonuclease gene 20kDa-like 2 [ Homo sapiens ]
• Official Symbol: ISG20L2
• Synonyms: Interferon Stimulated Exonuclease Gene 20 Like 2; Interferon Stimulated Exonuclease Gene 20kDa-Like 2; Interferon Stimulated Exonuclease Gene 20kDa Like 2; Interferon-Stimulated 20 KDa Exonuclease-Like 2; EC 3.1.-.-; HSD38
• Gene ID: 81875
• mRNA Refseq: NM_030980
• Protein Refseq: NP_112242
• MIM: 611930
• UniProt ID: Q9H9L3