Recombinant Full Length Human ISG20L2 Protein, GST-tagged
| Cat.No. : | ISG20L2-5755HF | 
| Product Overview : | Human ISG20L2 full-length ORF (BAB14212.1, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 353 amino acids | 
| Description : | This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014] | 
| Molecular Mass : | 65.23 kDa | 
| AA Sequence : | MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ISG20L2 interferon stimulated exonuclease gene 20kDa-like 2 [ Homo sapiens ] | 
| Official Symbol | ISG20L2 | 
| Synonyms | Interferon Stimulated Exonuclease Gene 20 Like 2; Interferon Stimulated Exonuclease Gene 20kDa-Like 2; Interferon Stimulated Exonuclease Gene 20kDa Like 2; Interferon-Stimulated 20 KDa Exonuclease-Like 2; EC 3.1.-.-; HSD38 | 
| Gene ID | 81875 | 
| mRNA Refseq | NM_030980 | 
| Protein Refseq | NP_112242 | 
| MIM | 611930 | 
| UniProt ID | Q9H9L3 | 
| ◆ Recombinant Proteins | ||
| ISG20L2-2765H | Recombinant Human ISG20L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ISG20L2-2308R | Recombinant Rhesus monkey ISG20L2 Protein, His-tagged | +Inquiry | 
| ISG20L2-2757R | Recombinant Rat ISG20L2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ISG20L2-4621M | Recombinant Mouse ISG20L2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ISG20L2-8327M | Recombinant Mouse ISG20L2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ISG20L2-5150HCL | Recombinant Human ISG20L2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ISG20L2 Products
Required fields are marked with *
My Review for All ISG20L2 Products
Required fields are marked with *
  
        
    
      
            