Recombinant Full Length Human ISG20L2 Protein, GST-tagged
Cat.No. : | ISG20L2-5755HF |
Product Overview : | Human ISG20L2 full-length ORF (BAB14212.1, 1 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 353 amino acids |
Description : | This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 65.23 kDa |
AA Sequence : | MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ISG20L2 interferon stimulated exonuclease gene 20kDa-like 2 [ Homo sapiens ] |
Official Symbol | ISG20L2 |
Synonyms | Interferon Stimulated Exonuclease Gene 20 Like 2; Interferon Stimulated Exonuclease Gene 20kDa-Like 2; Interferon Stimulated Exonuclease Gene 20kDa Like 2; Interferon-Stimulated 20 KDa Exonuclease-Like 2; EC 3.1.-.-; HSD38 |
Gene ID | 81875 |
mRNA Refseq | NM_030980 |
Protein Refseq | NP_112242 |
MIM | 611930 |
UniProt ID | Q9H9L3 |
◆ Recombinant Proteins | ||
ISG20L2-2765H | Recombinant Human ISG20L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ISG20L2-2308R | Recombinant Rhesus monkey ISG20L2 Protein, His-tagged | +Inquiry |
ISG20L2-2757R | Recombinant Rat ISG20L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISG20L2-4621M | Recombinant Mouse ISG20L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISG20L2-8327M | Recombinant Mouse ISG20L2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG20L2-5150HCL | Recombinant Human ISG20L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISG20L2 Products
Required fields are marked with *
My Review for All ISG20L2 Products
Required fields are marked with *