Recombinant Full Length Human ITGAV Protein
Cat.No. : | ITGAV-6962HF |
Product Overview : | Recombinant Human full-length ITGAV was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 1048 amino acids |
Description : | The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 116 kDa |
AA Sequence : | MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSQMFLLVGAPKANT TQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY DPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQV ELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIV SIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAML HLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNST LVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet; Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ITGAV integrin, alpha V [ Homo sapiens ] |
Official Symbol | ITGAV |
Synonyms | ITGAV; integrin, alpha V; antigen identified by monoclonal L230 , integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) , MSK8, vitronectin receptor , VNRA, VTNR; integrin alpha-V; CD51; integrin alphaVbeta3; vitronectin receptor subunit alpha; antigen identified by monoclonal L230; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); MSK8; VNRA; VTNR; DKFZp686A08142; |
Gene ID | 3685 |
mRNA Refseq | NM_002210 |
Protein Refseq | NP_002201 |
MIM | 193210 |
UniProt ID | P06756 |
◆ Recombinant Proteins | ||
Itgav-6764M | Recombinant Mouse Itgav protein, His & T7-tagged | +Inquiry |
ITGAV-4641M | Recombinant Mouse ITGAV Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGAV-3406Z | Recombinant Zebrafish ITGAV | +Inquiry |
ITGAV-26862TH | Recombinant Human ITGAV protein | +Inquiry |
ITGAV-5819B | Recombinant Bovine ITGAV and ITGB6 Protein (Phe31-Pro993, Gly22-Pro709), C-His & C-Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGAV-877HCL | Recombinant Human ITGAV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAV Products
Required fields are marked with *
My Review for All ITGAV Products
Required fields are marked with *