Recombinant Human ITGAV Protein (891-1048 aa), His-tagged
Cat.No. : | ITGAV-1427H |
Product Overview : | Recombinant Human ITGAV Protein (891-1048 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 891-1048 aa |
Description : | The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with Extracellular domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.7 kDa |
AA Sequence : | DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ITGAV integrin, alpha V [ Homo sapiens ] |
Official Symbol | ITGAV |
Synonyms | ITGAV; CD51; MSK8; VNRA; VTNR; DKFZp686A08142; |
Gene ID | 3685 |
mRNA Refseq | NM_001144999 |
Protein Refseq | NP_001138471 |
MIM | 193210 |
UniProt ID | P06756 |
◆ Recombinant Proteins | ||
ITGAV-2343H | Recombinant Human ITGAV Protein, His-tagged | +Inquiry |
ITGAV-26862TH | Recombinant Human ITGAV protein | +Inquiry |
ITGAVB3-103H | Active Recombinant Human ITGAVB3 | +Inquiry |
ITGA5-101H | Recombinant Human ITGAV/ITGB3 Heterodimer Protein, His-tagged | +Inquiry |
ITGAV-2136R | Recombinant Rhesus Macaque ITGAV Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGAV-877HCL | Recombinant Human ITGAV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGAV Products
Required fields are marked with *
My Review for All ITGAV Products
Required fields are marked with *
0
Inquiry Basket