Recombinant Human ITGAV Protein (891-1048 aa), His-tagged

Cat.No. : ITGAV-1427H
Product Overview : Recombinant Human ITGAV Protein (891-1048 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 891-1048 aa
Description : The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with Extracellular domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.7 kDa
AA Sequence : DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name ITGAV integrin, alpha V [ Homo sapiens ]
Official Symbol ITGAV
Synonyms ITGAV; CD51; MSK8; VNRA; VTNR; DKFZp686A08142;
Gene ID 3685
mRNA Refseq NM_001144999
Protein Refseq NP_001138471
MIM 193210
UniProt ID P06756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAV Products

Required fields are marked with *

My Review for All ITGAV Products

Required fields are marked with *

0
cart-icon
0
compare icon