Recombinant Full Length Human ITGB3BP Protein, GST-tagged
Cat.No. : | ITGB3BP-5781HF |
Product Overview : | Human ITGB3BP full-length ORF ( NP_055103.3, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 177 amino acids |
Description : | This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGB3BP integrin beta 3 binding protein (beta3-endonexin) [ Homo sapiens ] |
Official Symbol | ITGB3BP |
Synonyms | ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R; |
Gene ID | 23421 |
mRNA Refseq | NM_001206739 |
Protein Refseq | NP_001193668 |
MIM | 605494 |
UniProt ID | Q13352 |
◆ Recombinant Proteins | ||
ITGB3BP-5781HF | Recombinant Full Length Human ITGB3BP Protein, GST-tagged | +Inquiry |
ITGB3BP-3450C | Recombinant Chicken ITGB3BP | +Inquiry |
ITGB3BP-2506H | Recombinant Human ITGB3BP protein, His-tagged | +Inquiry |
ITGB3BP-180H | Recombinant Human ITGB3BP, GST-tagged | +Inquiry |
ITGB3BP-1967HFL | Recombinant Full Length Human ITGB3BP Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB3BP-5123HCL | Recombinant Human ITGB3BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3BP Products
Required fields are marked with *
My Review for All ITGB3BP Products
Required fields are marked with *