Recombinant Human ITGB3BP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ITGB3BP-3126H
Product Overview : ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.
Molecular Mass : 20.2 kDa
AA Sequence : MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ITGB3BP integrin subunit beta 3 binding protein [ Homo sapiens (human) ]
Official Symbol ITGB3BP
Synonyms ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R;
Gene ID 23421
mRNA Refseq NM_014288
Protein Refseq NP_055103
MIM 605494
UniProt ID Q13352

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGB3BP Products

Required fields are marked with *

My Review for All ITGB3BP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon