Recombinant Human ITGB3BP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ITGB3BP-3126H |
Product Overview : | ITGB3BP MS Standard C13 and N15-labeled recombinant protein (NP_055103) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ITGB3BP integrin subunit beta 3 binding protein [ Homo sapiens (human) ] |
Official Symbol | ITGB3BP |
Synonyms | ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R; |
Gene ID | 23421 |
mRNA Refseq | NM_014288 |
Protein Refseq | NP_055103 |
MIM | 605494 |
UniProt ID | Q13352 |
◆ Recombinant Proteins | ||
ITGB3BP-1967HFL | Recombinant Full Length Human ITGB3BP Protein, C-Flag-tagged | +Inquiry |
ITGB3BP-543H | Recombinant Human integrin beta 3 binding protein (beta3-endonexin), His-tagged | +Inquiry |
ITGB3BP-1217H | Recombinant Human ITGB3BP Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGB3BP-180H | Recombinant Human ITGB3BP, GST-tagged | +Inquiry |
ITGB3BP-3450C | Recombinant Chicken ITGB3BP | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB3BP-5123HCL | Recombinant Human ITGB3BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB3BP Products
Required fields are marked with *
My Review for All ITGB3BP Products
Required fields are marked with *
0
Inquiry Basket