Recombinant Full Length Human IYD Protein, GST-tagged

Cat.No. : IYD-5853HF
Product Overview : Human IYD full-length ORF ( NP_981932.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 289 amino acids
Description : This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Molecular Mass : 59.8 kDa
AA Sequence : MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IYD iodotyrosine deiodinase [ Homo sapiens (human) ]
Official Symbol IYD
Synonyms IYD; iodotyrosine deiodinase; TDH4; IYD-1; DEHAL1; C6orf71; iodotyrosine deiodinase 1; iodotyrosine dehalogenase 1; EC 1.21.1.1
Gene ID 389434
mRNA Refseq NM_001164694
Protein Refseq NP_001158166
MIM 612025
UniProt ID Q6PHW0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IYD Products

Required fields are marked with *

My Review for All IYD Products

Required fields are marked with *

0
cart-icon