Recombinant Human IYD Protein, GST-tagged
Cat.No. : | IYD-4938H |
Product Overview : | Human IYD full-length ORF ( NP_981932.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 59.8 kDa |
AA Sequence : | MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IYD iodotyrosine deiodinase [ Homo sapiens (human) ] |
Official Symbol | IYD |
Synonyms | IYD; iodotyrosine deiodinase; TDH4; IYD-1; DEHAL1; C6orf71; iodotyrosine deiodinase 1; iodotyrosine dehalogenase 1; EC 1.21.1.1 |
Gene ID | 389434 |
mRNA Refseq | NM_001164694 |
Protein Refseq | NP_001158166 |
MIM | 612025 |
UniProt ID | Q6PHW0 |
◆ Recombinant Proteins | ||
IYD-3132R | Recombinant Rat IYD Protein | +Inquiry |
IYD-8401M | Recombinant Mouse IYD Protein | +Inquiry |
IYD-4938H | Recombinant Human IYD Protein, GST-tagged | +Inquiry |
IYD-5853HF | Recombinant Full Length Human IYD Protein, GST-tagged | +Inquiry |
IYD-4663M | Recombinant Mouse IYD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IYD-885HCL | Recombinant Human IYD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IYD Products
Required fields are marked with *
My Review for All IYD Products
Required fields are marked with *