Recombinant Full Length Human KCNE5 Protein, C-Flag-tagged

Cat.No. : KCNE5-1231HFL
Product Overview : Recombinant Full Length Human KCNE5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 14.8 kDa
AA Sequence : MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE
RVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Ion Channels: Other, Transmembrane
Full Length : Full L.
Gene Name KCNE5 potassium voltage-gated channel subfamily E regulatory subunit 5 [ Homo sapiens (human) ]
Official Symbol KCNE5
Synonyms KCNE1L
Gene ID 23630
mRNA Refseq NM_012282.4
Protein Refseq NP_036414.1
MIM 300328
UniProt ID Q9UJ90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNE5 Products

Required fields are marked with *

My Review for All KCNE5 Products

Required fields are marked with *

0
cart-icon
0
compare icon