Recombinant Full Length Human KCNE5 Protein, C-Flag-tagged

• Cat.No.: KCNE5-1231HFL
• Product Overview: Recombinant Full Length Human KCNE5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.8 kDa
• AA Sequence: MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE
  RVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: KCNE5 potassium voltage-gated channel subfamily E regulatory subunit 5 [ Homo sapiens (human) ]
• Official Symbol: KCNE5
• Synonyms: KCNE1L
• Gene ID: 23630
• mRNA Refseq: NM_012282.4
• Protein Refseq: NP_036414.1
• MIM: 300328
• UniProt ID: Q9UJ90