Recombinant Human KCNE5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KCNE5-3655H
Product Overview : KCNE1L MS Standard C13 and N15-labeled recombinant protein (NP_036414) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome.
Molecular Mass : 15 kDa
AA Sequence : MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KCNE5 potassium voltage-gated channel subfamily E regulatory subunit 5 [ Homo sapiens (human) ]
Official Symbol KCNE5
Synonyms KCNE5; potassium voltage-gated channel subfamily E regulatory subunit 5; KCNE1L; potassium voltage-gated channel subfamily E regulatory beta subunit 5; AMME syndrome candidate gene 2 protein; AMMECR2 protein; KCNE1-like; cardiac voltage-gated potassium channel accessory subunit 5; potassium channel subunit beta MiRP4; potassium voltage-gated channel subfamily E member 1-like protein; potassium voltage-gated channel, Isk-related family, member 1-like
Gene ID 23630
mRNA Refseq NM_012282
Protein Refseq NP_036414
MIM 300328
UniProt ID Q9UJ90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNE5 Products

Required fields are marked with *

My Review for All KCNE5 Products

Required fields are marked with *

0
cart-icon
0
compare icon