Recombinant Human KCNE5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCNE5-3655H
• Product Overview: KCNE1L MS Standard C13 and N15-labeled recombinant protein (NP_036414) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome.
• Molecular Mass: 15 kDa
• AA Sequence: MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCNE5 potassium voltage-gated channel subfamily E regulatory subunit 5 [ Homo sapiens (human) ]
• Official Symbol: KCNE5
• Synonyms: KCNE5; potassium voltage-gated channel subfamily E regulatory subunit 5; KCNE1L; potassium voltage-gated channel subfamily E regulatory beta subunit 5; AMME syndrome candidate gene 2 protein; AMMECR2 protein; KCNE1-like; cardiac voltage-gated potassium channel accessory subunit 5; potassium channel subunit beta MiRP4; potassium voltage-gated channel subfamily E member 1-like protein; potassium voltage-gated channel, Isk-related family, member 1-like
• Gene ID: 23630
• mRNA Refseq: NM_012282
• Protein Refseq: NP_036414
• MIM: 300328
• UniProt ID: Q9UJ90