Recombinant Full Length Human KDSR Protein, GST-tagged
Cat.No. : | KDSR-5239HF |
Product Overview : | Human FVT1 full-length ORF ( AAH08797.1, 12 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 12-332 amino acids |
Description : | The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq |
Molecular Mass : | 61.05 kDa |
AA Sequence : | FVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens ] |
Official Symbol | KDSR |
Synonyms | KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1, FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1; FVT-1; KDS reductase; 3-dehydrosphinganine reductase; follicular variant translocation protein 1; follicular lymphoma variant translocation 1; short chain dehydrogenase/reductase family 35C, member 1; FVT1; FLJ36555; FLJ92680; |
Gene ID | 2531 |
mRNA Refseq | NM_002035 |
Protein Refseq | NP_002026 |
MIM | 136440 |
UniProt ID | Q06136 |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDSR Products
Required fields are marked with *
My Review for All KDSR Products
Required fields are marked with *
0
Inquiry Basket