Recombinant Full Length Human KHDC3L Protein, GST-tagged

Cat.No. : KHDC3L-3866HF
Product Overview : Human C6orf221 full-length ORF ( ADR83511.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 217 amino acids
Description : The protein encoded by this gene belongs to the KHDC1 family, members of which contain an atypical KH domain that may not bind RNA like canonical KH domains. This gene is specifically expressed in the oocytes, and recent studies suggest that it may function as a regulator of genomic imprinting in the oocyte. Mutations in this gene are associated with recurrent biparental complete hydatidiform mole. [provided by RefSeq, Dec 2011]
Molecular Mass : 23.9 kDa
AA Sequence : MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KHDC3L KH domain containing 3 like, subcortical maternal complex member [ Homo sapiens (human) ]
Official Symbol KHDC3L
Synonyms C6orf221; KHDC3L; KH domain containing 3 like, subcortical maternal complex member; ECAT1; HYDM2; KHDC3-like proteinl; ES cell-associated transcript 1 protein
Gene ID 154288
mRNA Refseq NM_001017361
Protein Refseq NP_001017361
MIM 611687
UniProt ID Q587J8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KHDC3L Products

Required fields are marked with *

My Review for All KHDC3L Products

Required fields are marked with *

0
cart-icon