Recombinant Human KHDC3L Protein, GST-tagged
| Cat.No. : | KHDC3L-5230H |
| Product Overview : | Human C6orf221 full-length ORF ( ADR83511.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the KHDC1 family, members of which contain an atypical KH domain that may not bind RNA like canonical KH domains. This gene is specifically expressed in the oocytes, and recent studies suggest that it may function as a regulator of genomic imprinting in the oocyte. Mutations in this gene are associated with recurrent biparental complete hydatidiform mole. [provided by RefSeq, Dec 2011] |
| Molecular Mass : | 23.9 kDa |
| AA Sequence : | MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KHDC3L KH domain containing 3 like, subcortical maternal complex member [ Homo sapiens (human) ] |
| Official Symbol | KHDC3L |
| Synonyms | C6orf221; KHDC3L; KH domain containing 3 like, subcortical maternal complex member; ECAT1; HYDM2; KHDC3-like proteinl; ES cell-associated transcript 1 protein |
| Gene ID | 154288 |
| mRNA Refseq | NM_001017361 |
| Protein Refseq | NP_001017361 |
| MIM | 611687 |
| UniProt ID | Q587J8 |
| ◆ Recombinant Proteins | ||
| KHDC3L-5230H | Recombinant Human KHDC3L Protein, GST-tagged | +Inquiry |
| KHDC3L-2627H | Recombinant Human KHDC3L protein, His-tagged | +Inquiry |
| KHDC3L-3204H | Recombinant Human KHDC3L Protein, His (Fc)-Avi-tagged | +Inquiry |
| KHDC3L-1071H | Recombinant Human KHDC3L | +Inquiry |
| KHDC3L-3866HF | Recombinant Full Length Human KHDC3L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KHDC3L-7986HCL | Recombinant Human C6orf221 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KHDC3L Products
Required fields are marked with *
My Review for All KHDC3L Products
Required fields are marked with *
