Recombinant Full Length Human KLHL3 Protein, C-Flag-tagged
Cat.No. : | KLHL3-1136HFL |
Product Overview : | Recombinant Full Length Human KLHL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is ubiquitously expressed and encodes a full-length protein which has an N-terminal BTB domain followed by a BACK domain and six kelch-like repeats in the C-terminus. These kelch-like repeats promote substrate ubiquitination of bound proteins via interaction of the BTB domain with the CUL3 (cullin 3) component of a cullin-RING E3 ubiquitin ligase (CRL) complex. Muatations in this gene cause pseudohypoaldosteronism type IID (PHA2D); a rare Mendelian syndrome featuring hypertension, hyperkalaemia and metabolic acidosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.8 kDa |
AA Sequence : | MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAA CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCC DFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSE EKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPL DQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVY AVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNE WFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSG QLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPV TDKWTLLPTNMSTGRSYAGVAVIHKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | KLHL3 kelch like family member 3 [ Homo sapiens (human) ] |
Official Symbol | KLHL3 |
Synonyms | PHA2D |
Gene ID | 26249 |
mRNA Refseq | NM_017415.3 |
Protein Refseq | NP_059111.2 |
MIM | 605775 |
UniProt ID | Q9UH77 |
◆ Recombinant Proteins | ||
KLHL3-1410H | Recombinant Human KLHL3 protein, His-tagged | +Inquiry |
KLHL3-2011H | Recombinant Human KLHL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLHL3-2428R | Recombinant Rhesus monkey KLHL3 Protein, His-tagged | +Inquiry |
KLHL3-109H | Recombinant Human KLHL3 protein, GST-tagged | +Inquiry |
KLHL3-2249R | Recombinant Rhesus Macaque KLHL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL3-4908HCL | Recombinant Human KLHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLHL3 Products
Required fields are marked with *
My Review for All KLHL3 Products
Required fields are marked with *
0
Inquiry Basket