Recombinant Full Length Human KLK5 Protein, GST-tagged

Cat.No. : KLK5-5859HF
Product Overview : Human KLK5 full-length ORF ( NP_036559.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 293 amino acids
Description : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Molecular Mass : 58.4 kDa
AA Sequence : MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLK5 kallikrein-related peptidase 5 [ Homo sapiens ]
Official Symbol KLK5
Synonyms KLK5; kallikrein-related peptidase 5; kallikrein 5; kallikrein-5; KLK L2; SCTE; kallikrein-like protein 2; stratum corneum tryptic enzyme; KLKL2; KLK-L2;
Gene ID 25818
mRNA Refseq NM_001077491
Protein Refseq NP_001070959
MIM 605643
UniProt ID Q9Y337

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK5 Products

Required fields are marked with *

My Review for All KLK5 Products

Required fields are marked with *

0
cart-icon
0
compare icon