Recombinant Human KLK5 Protein, GST-tagged
Cat.No. : | KLK5-4934H |
Product Overview : | Human KLK5 full-length ORF ( NP_036559.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq |
Molecular Mass : | 58.4 kDa |
AA Sequence : | MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLK5 kallikrein-related peptidase 5 [ Homo sapiens ] |
Official Symbol | KLK5 |
Synonyms | KLK5; kallikrein-related peptidase 5; kallikrein 5; kallikrein-5; KLK L2; SCTE; kallikrein-like protein 2; stratum corneum tryptic enzyme; KLKL2; KLK-L2; |
Gene ID | 25818 |
mRNA Refseq | NM_001077491 |
Protein Refseq | NP_001070959 |
MIM | 605643 |
UniProt ID | Q9Y337 |
◆ Recombinant Proteins | ||
KLK5-2515H | Recombinant Human Kallikrein-Related Peptidase 5, His-tagged | +Inquiry |
KLK5-4171H | Recombinant Human KLK5 Protein (IIe67-Ser293), C-His tagged | +Inquiry |
KLK5-2254R | Recombinant Rhesus Macaque KLK5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klk5-3725M | Recombinant Mouse Klk5 Protein, Myc/DDK-tagged | +Inquiry |
Klk5-1978M | Active Recombinant Mouse Kallikrein Related-Peptidase 5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK5-948HCL | Recombinant Human KLK5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK5 Products
Required fields are marked with *
My Review for All KLK5 Products
Required fields are marked with *