Recombinant Full Length Human KRT27 Protein, GST-tagged
Cat.No. : | KRT27-5976HF |
Product Overview : | Human KRT27 full-length ORF ( AAI66634.1, 1 a.a. - 459 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 459 amino acids |
Description : | This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. [provided by RefSeq |
Molecular Mass : | 50.5 kDa |
AA Sequence : | MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGGGLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENELALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSARNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTIVKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT27 keratin 27 [ Homo sapiens ] |
Official Symbol | KRT27 |
Synonyms | KRT27; keratin 27; keratin 25C , KRT25C; keratin, type I cytoskeletal 27; K27; K25C; CK-27; keratin-27; keratin 25C; keratin-25C; cytokeratin-27; type I inner root sheath specific keratin 25 irs3; type I inner root sheath-specific keratin-K25irs3; KRT25C; |
Gene ID | 342574 |
mRNA Refseq | NM_181537 |
Protein Refseq | NP_853515 |
MIM | 616676 |
UniProt ID | Q7Z3Y8 |
◆ Recombinant Proteins | ||
KRT27-4921M | Recombinant Mouse KRT27 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT27-3321R | Recombinant Rat KRT27 Protein | +Inquiry |
KRT27-4858H | Recombinant Human KRT27 Protein, GST-tagged | +Inquiry |
KRT27-8830M | Recombinant Mouse KRT27 Protein | +Inquiry |
KRT27-2977R | Recombinant Rat KRT27 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT27 Products
Required fields are marked with *
My Review for All KRT27 Products
Required fields are marked with *