Recombinant Full Length Human KRTAP3-2 Protein, GST-tagged
Cat.No. : | KRTAP3-2-5811HF |
Product Overview : | Human KRTAP3-2 full-length ORF ( ABM86541.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 98 amino acids |
Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq |
Molecular Mass : | 37.18 kDa |
AA Sequence : | MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPSTI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP3-2 keratin associated protein 3-2 [ Homo sapiens (human) ] |
Official Symbol | KRTAP3-2 |
Synonyms | KRTAP3-2; keratin associated protein 3-2; KAP3.2; KRTAP3.2; keratin-associated protein 3-2; high sulfur keratin-associated protein 3.2; keratin associated protein 3.2 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=83897 |
mRNA Refseq | NM_031959 |
Protein Refseq | NP_114165 |
UniProt ID | Q9BYR7 |
◆ Recombinant Proteins | ||
KRTAP3-2-3289H | Recombinant Human KRTAP3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP3-2-4814H | Recombinant Human KRTAP3-2 Protein, GST-tagged | +Inquiry |
KRTAP3-2-5811HF | Recombinant Full Length Human KRTAP3-2 Protein, GST-tagged | +Inquiry |
KRTAP3-2-3062H | Recombinant Human KRTAP3-2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KRTAP3-2-4957M | Recombinant Mouse KRTAP3-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTAP3-2 Products
Required fields are marked with *
My Review for All KRTAP3-2 Products
Required fields are marked with *
0
Inquiry Basket