Recombinant Full Length Human Kunitz-Type Protease Inhibitor 2(Spint2) Protein, His-Tagged
Cat.No. : | RFL22981HF |
Product Overview : | Recombinant Full Length Human Kunitz-type protease inhibitor 2(SPINT2) Protein (O43291) (28-252aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (28-252) |
Form : | Lyophilized powder |
AA Sequence : | ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPINT2 |
Synonyms | SPINT2; HAI2; KOP; Kunitz-type protease inhibitor 2; Hepatocyte growth factor activator inhibitor type 2; HAI-2; Placental bikunin |
UniProt ID | O43291 |
◆ Recombinant Proteins | ||
SPINT2-2061HFL | Recombinant Full Length Human SPINT2 Protein, C-Flag-tagged | +Inquiry |
SPINT2-384H | Recombinant Human serine peptidase inhibitor, Kunitz type, 2, His-tagged | +Inquiry |
SPINT2-2086H | Recombinant Human SPINT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPINT2-4639Z | Recombinant Zebrafish SPINT2 | +Inquiry |
SPINT2-209H | Active Recombinant Human SPINT2 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINT2-2845MCL | Recombinant Mouse SPINT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINT2 Products
Required fields are marked with *
My Review for All SPINT2 Products
Required fields are marked with *