Recombinant Full Length Human LCP2 Protein
Cat.No. : | LCP2-281HF |
Product Overview : | Recombinant full length Human SLP76 with N terminal proprietary tag, predicted mwt: 84.74kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 533 amino acids |
Description : | SLP-76 was originally identified as a substrate of the ZAP-70 protein tyrosine kinase following T cell receptor (TCR) ligation in the leukemic T cell line Jurkat. The SLP-76 locus has been localized to human chromosome 5q33 and the gene structure has been partially characterized in mice. The human and murine cDNAs both encode 533 amino acid proteins that are 72% identical and comprised of three modular domains. The NH2-terminus contains an acidic region that includes a PEST domain and several tyrosine residues which are phosphorylated following TCR ligation. SLP-76 also contains a central proline-rich domain and a COOH-terminal SH2 domain. A number of additional proteins have been identified that associate with SLP-76 both constitutively and inducibly following receptor ligation, supporting the notion that SLP-76 functions as an adaptor or scaffold protein. Studies using SLP-76 deficient T cell lines or mice have provided strong evidence that SLP-76 plays a positive role in promoting T cell development and activation as well as mast cell and platelet function. |
Form : | Liquid |
Molecular Mass : | 84.740kDa inclusive of tags |
AA Sequence : | MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYH IDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRS IFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSI LPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRREND EDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKIN QDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGS RYQCTLTHAAGYP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ] |
Official Symbol | LCP2 |
Synonyms | LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain c |
Gene ID | 3937 |
mRNA Refseq | NM_005565 |
Protein Refseq | NP_005556 |
MIM | 601603 |
UniProt ID | Q13094 |
◆ Recombinant Proteins | ||
LCP2-587HFL | Recombinant Full Length Human LCP2 Protein, C-Flag-tagged | +Inquiry |
LCP2-4427H | Recombinant Human LCP2 Protein (Met1-Pro533), C-His tagged | +Inquiry |
LCP2-2483R | Recombinant Rhesus monkey LCP2 Protein, His-tagged | +Inquiry |
LCP2-2304R | Recombinant Rhesus Macaque LCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCP2-281HF | Recombinant Full Length Human LCP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCP2-4794HCL | Recombinant Human LCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCP2 Products
Required fields are marked with *
My Review for All LCP2 Products
Required fields are marked with *
0
Inquiry Basket