Recombinant Full Length Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3(Lilrb3) Protein, His-Tagged
Cat.No. : | RFL29488HF |
Product Overview : | Recombinant Full Length Human Leukocyte immunoglobulin-like receptor subfamily B member 3(LILRB3) Protein (O75022) (24-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-631) |
Form : | Lyophilized powder |
AA Sequence : | GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LILRB3 |
Synonyms | LILRB3; ILT5; LIR3; Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; Leukocyte immunoglobulin-like receptor 3; CD85 antigen-like family member A; Immunoglobulin-like transcript 5; ILT-5; Monocyte inhibitory receptor HL9; CD antigen CD85 |
UniProt ID | O75022 |
◆ Recombinant Proteins | ||
LILRB3-356H | Recombinant Human LILRB3 Protein, Fc-tagged | +Inquiry |
LILRB3-199H | Recombinant Human LILRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRB3-522H | Recombinant Human LILRB3 protein, His-Avi-tagged | +Inquiry |
LILRB3-362H | Recombinant Human LILRB3 protein, Fc-tagged | +Inquiry |
Lilrb3-5332M | Recombinant Mouse Lilrb3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRB3 Products
Required fields are marked with *
My Review for All LILRB3 Products
Required fields are marked with *
0
Inquiry Basket