Recombinant Mouse LILRB3 Protein (664-841 aa), His-tagged
| Cat.No. : | LILRB3-1445M |
| Product Overview : | Recombinant Mouse LILRB3 Protein (664-841 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 664-841 aa |
| Description : | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 21.6 kDa |
| AA Sequence : | RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Lilrb3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Mus musculus ] |
| Official Symbol | LILRB3 |
| Synonyms | LILRB3; Gp91; Pirb; LIR-3; PIR-B; |
| Gene ID | 18733 |
| mRNA Refseq | NM_011095 |
| Protein Refseq | NP_035225 |
| UniProt ID | P97484 |
| ◆ Recombinant Proteins | ||
| LILRB3-356H | Recombinant Human LILRB3 Protein, Fc-tagged | +Inquiry |
| LILRB3-012H | Recombinant Human LILRB3 Protein, His-tagged | +Inquiry |
| LILRB3-219H | Active Recombinant Human LILRB3, Fc Chimera | +Inquiry |
| LILRB3-522H | Recombinant Human LILRB3 protein, His-Avi-tagged | +Inquiry |
| LILRB3-199H | Recombinant Human LILRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
| LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB3 Products
Required fields are marked with *
My Review for All LILRB3 Products
Required fields are marked with *



