Description : |
This gene is a member of the fringe gene family which also includes radical and manic fringe genes. They all encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. This gene product is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Multiple transcript variants encoding different isoforms have been found for this gene. |
Source : |
In Vitro Cell Free System |
Species : |
Human |
Form : |
Liquid |
Molecular Mass : |
53.240kDa inclusive of tags |
Protein Length : |
250 amino acids |
AA Sequence : |
MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCS AAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRA LLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVH FWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPD DCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQ VTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIHCHLYPD TPWCPRTAIF |
Purity : |
Proprietary Purification |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |