Recombinant Full Length Human LGALS3 Protein, C-Flag-tagged
Cat.No. : | LGALS3-392HFL |
Product Overview : | Recombinant Full Length Human LGALS3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26 kDa |
AA Sequence : | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | LGALS3 galectin 3 [ Homo sapiens (human) ] |
Official Symbol | LGALS3 |
Synonyms | L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2 |
Gene ID | 3958 |
mRNA Refseq | NM_002306.4 |
Protein Refseq | NP_002297.2 |
MIM | 153619 |
UniProt ID | P17931 |
◆ Recombinant Proteins | ||
Lgals3-409M | Recombinant Mouse Lgals3 Protein, His-tagged | +Inquiry |
LGALS3-222H | Recombinant Human LGALS3, His-tagged | +Inquiry |
LGALS3-1319H | Recombinant Human LGALS3 protein, His-tagged | +Inquiry |
LGALS3-408H | Recombinant Human LGALS3 Protein, His-tagged | +Inquiry |
LGALS3-12H | Recombinant Human LGALS3, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS3 Products
Required fields are marked with *
My Review for All LGALS3 Products
Required fields are marked with *
0
Inquiry Basket