Recombinant Rat Lgals3 protein, His-tagged
Cat.No. : | Lgals3-3166R |
Product Overview : | Recombinant Rat Lgals3 protein(P08699)(2-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-262aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Lgals3 lectin, galactoside-binding, soluble, 3 [ Rattus norvegicus ] |
Official Symbol | Lgals3 |
Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; galectin-3; CBP 35; lectin L-29; 35 kDa lectin; mac-2 antigen; IgE binding protein; igE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; lectin, galactose binding, soluble 3; gal-3; MGC105387; |
Gene ID | 83781 |
mRNA Refseq | NM_031832 |
Protein Refseq | NP_114020 |
◆ Recombinant Proteins | ||
LGALS3-261H | Recombinant Human LGALS3 Protein, His-tagged | +Inquiry |
LGALS3-191H | Active Recombinant Human LGALS3 Protein (Ala2-Ile250), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS3-2677H | Recombinant Human LGALS3 protein(91-250 aa), C-His-tagged | +Inquiry |
LGALS3-2501R | Recombinant Rhesus monkey LGALS3 Protein, His-tagged | +Inquiry |
LGALS3-4952H | Recombinant Human LGALS3 protein | +Inquiry |
◆ Native Proteins | ||
LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals3 Products
Required fields are marked with *
My Review for All Lgals3 Products
Required fields are marked with *