Recombinant Rat Lgals3 protein, His-tagged
| Cat.No. : | Lgals3-3166R |
| Product Overview : | Recombinant Rat Lgals3 protein(P08699)(2-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-262aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.1 kDa |
| AA Sequence : | ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Lgals3 lectin, galactoside-binding, soluble, 3 [ Rattus norvegicus ] |
| Official Symbol | Lgals3 |
| Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; galectin-3; CBP 35; lectin L-29; 35 kDa lectin; mac-2 antigen; IgE binding protein; igE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; lectin, galactose binding, soluble 3; gal-3; MGC105387; |
| Gene ID | 83781 |
| mRNA Refseq | NM_031832 |
| Protein Refseq | NP_114020 |
| ◆ Recombinant Proteins | ||
| LGALS3-2501R | Recombinant Rhesus monkey LGALS3 Protein, His-tagged | +Inquiry |
| LGALS3-2322R | Recombinant Rhesus Macaque LGALS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LGALS3-6914H | Active Recombinant Human LGALS3 Protein, His tagged | +Inquiry |
| LGALS3-261H | Recombinant Human LGALS3 Protein, His-tagged | +Inquiry |
| LGALS3-693H | Recombinant Human LGALS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
| LGALS3-224HKCL | Human LGALS3 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals3 Products
Required fields are marked with *
My Review for All Lgals3 Products
Required fields are marked with *



