Recombinant Full Length Human LINGO1 Protein, C-Flag-tagged
Cat.No. : | LINGO1-349HFL |
Product Overview : | Recombinant Full Length Human LINGO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIP TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFT GLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA LSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPY LAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTL EESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQ DNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIA TTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | LINGO1 leucine rich repeat and Ig domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | LINGO1 |
Synonyms | LERN1; MRT64; LRRN6A; UNQ201 |
Gene ID | 84894 |
mRNA Refseq | NM_032808.7 |
Protein Refseq | NP_116197.4 |
MIM | 609791 |
UniProt ID | Q96FE5 |
◆ Recombinant Proteins | ||
LINGO1-001H | Recombinant Human LINGO1 Protein, His-tagged | +Inquiry |
LINGO1-485H | Recombinant Human LINGO1 protein, His-tagged | +Inquiry |
LINGO1-2333M | Recombinant Mouse LINGO1 Protein (37-555 aa), His-tagged | +Inquiry |
LINGO1-2182C | Recombinant Chicken LINGO1 | +Inquiry |
LINGO1-9121M | Recombinant Mouse LINGO1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LINGO1-4728HCL | Recombinant Human LINGO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LINGO1 Products
Required fields are marked with *
My Review for All LINGO1 Products
Required fields are marked with *
0
Inquiry Basket