Recombinant Full Length Human LMAN1 Protein, C-Flag-tagged
Cat.No. : | LMAN1-224HFL |
Product Overview : | Recombinant Full Length Human LMAN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.2 kDa |
AA Sequence : | MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHA GNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGS ADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQN TLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKE ISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR QLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSLSETVRLVSGM QHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTV LFIGYIMYRSQQEAAAKKFFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | LMAN1 lectin, mannose binding 1 [ Homo sapiens (human) ] |
Official Symbol | LMAN1 |
Synonyms | MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53 |
Gene ID | 3998 |
mRNA Refseq | NM_005570.4 |
Protein Refseq | NP_005561.1 |
MIM | 601567 |
UniProt ID | P49257 |
◆ Recombinant Proteins | ||
LMAN1-9142M | Recombinant Mouse LMAN1 Protein | +Inquiry |
LMAN1-2348R | Recombinant Rhesus Macaque LMAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMAN1-3423R | Recombinant Rat LMAN1 Protein | +Inquiry |
LMAN1-2528R | Recombinant Rhesus monkey LMAN1 Protein, His-tagged | +Inquiry |
Lman1-3796M | Recombinant Mouse Lman1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN1-4719HCL | Recombinant Human LMAN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMAN1 Products
Required fields are marked with *
My Review for All LMAN1 Products
Required fields are marked with *
0
Inquiry Basket