Recombinant Full Length Human LMCD1 Protein, C-Flag-tagged
Cat.No. : | LMCD1-1966HFL |
Product Overview : | Recombinant Full Length Human LMCD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.7 kDa |
AA Sequence : | MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT KGQLLCPTCSKSKRS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LMCD1 LIM and cysteine rich domains 1 [ Homo sapiens (human) ] |
Official Symbol | LMCD1 |
Synonyms | dyxin; LIM and cysteine-rich domains 1 |
Gene ID | 29995 |
mRNA Refseq | NM_014583.4 |
Protein Refseq | NP_055398.1 |
MIM | 604859 |
UniProt ID | Q9NZU5 |
◆ Recombinant Proteins | ||
LMCD1-11296Z | Recombinant Zebrafish LMCD1 | +Inquiry |
LMCD1-1303H | Recombinant Human LMCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lmcd1-3801M | Recombinant Mouse Lmcd1 Protein, Myc/DDK-tagged | +Inquiry |
LMCD1-558H | Recombinant Human LMCD1 Protein, His-tagged | +Inquiry |
LMCD1-3292H | Recombinant Human LMCD1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMCD1-4715HCL | Recombinant Human LMCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMCD1 Products
Required fields are marked with *
My Review for All LMCD1 Products
Required fields are marked with *
0
Inquiry Basket