Recombinant Full Length Human LMO4 Protein, His tagged
Cat.No. : | LMO4-27549TH |
Product Overview : | Recombinant Full Length Human LMO4 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-165 aa |
Description : | This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. |
Tag : | His |
Molecular Mass : | 18 kDa |
AA Sequence : | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
Endotoxin : | <2 EU/μg by LAL |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 1 mg/mL |
Gene Name | LMO4 LIM domain only 4 [ Homo sapiens (human) ] |
Official Symbol | LMO4 |
Synonyms | LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4; |
Gene ID | 8543 |
mRNA Refseq | NM_006769 |
Protein Refseq | NP_006760 |
MIM | 603129 |
UniProt ID | P61968 |
◆ Recombinant Proteins | ||
LMO4-1307H | Recombinant Human LMO4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMO4-2356R | Recombinant Rhesus Macaque LMO4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LMO4-2536R | Recombinant Rhesus monkey LMO4 Protein, His-tagged | +Inquiry |
LMO4-772HFL | Recombinant Full Length Human LMO4 Protein, C-Flag-tagged | +Inquiry |
LMO4-5688C | Recombinant Chicken LMO4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMO4-4707HCL | Recombinant Human LMO4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMO4 Products
Required fields are marked with *
My Review for All LMO4 Products
Required fields are marked with *