Recombinant Full Length Human LMO4 Protein, His tagged
| Cat.No. : | LMO4-27549TH |
| Product Overview : | Recombinant Full Length Human LMO4 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-165 aa |
| Description : | This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. |
| Tag : | His |
| Molecular Mass : | 18 kDa |
| AA Sequence : | MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
| Endotoxin : | <2 EU/μg by LAL |
| Purity : | > 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL |
| Gene Name | LMO4 LIM domain only 4 [ Homo sapiens (human) ] |
| Official Symbol | LMO4 |
| Synonyms | LMO4; LIM domain only 4; LIM domain transcription factor LMO4; LMO-4; breast tumor autoantigen; LIM domain only protein 4; |
| Gene ID | 8543 |
| mRNA Refseq | NM_006769 |
| Protein Refseq | NP_006760 |
| MIM | 603129 |
| UniProt ID | P61968 |
| ◆ Recombinant Proteins | ||
| LMO4-772HFL | Recombinant Full Length Human LMO4 Protein, C-Flag-tagged | +Inquiry |
| Lmo4-1328M | Recombinant Mouse Lmo4 Protein, MYC/DDK-tagged | +Inquiry |
| LMO4-2356R | Recombinant Rhesus Macaque LMO4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LMO4-3179H | Recombinant Human LMO4 protein, GST-tagged | +Inquiry |
| LMO4-2536R | Recombinant Rhesus monkey LMO4 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LMO4-4707HCL | Recombinant Human LMO4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMO4 Products
Required fields are marked with *
My Review for All LMO4 Products
Required fields are marked with *
