Recombinant Full Length Human LMX1A Protein

Cat.No. : LMX1A-291HF
Product Overview : Recombinant full length Human LMX1A (aa 1-100) with N-terminal proprietary tag, 37.07 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 100 amino acids
Description : Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al.
Form : Liquid
Molecular Mass : 37.070kDa inclusive of tags
AA Sequence : MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name LMX1A LIM homeobox transcription factor 1, alpha [ Homo sapiens ]
Official Symbol LMX1A
Synonyms LMX1A; LIM homeobox transcription factor 1, alpha; LMX1; LIM homeobox transcription factor 1-alpha; LMX1.1
Gene ID 4009
mRNA Refseq NM_001174069
Protein Refseq NP_001167540
MIM 600298
UniProt ID Q8TE12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMX1A Products

Required fields are marked with *

My Review for All LMX1A Products

Required fields are marked with *

0
cart-icon
0
compare icon