Recombinant Full Length Human LMX1A Protein
Cat.No. : | LMX1A-291HF |
Product Overview : | Recombinant full length Human LMX1A (aa 1-100) with N-terminal proprietary tag, 37.07 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 100 amino acids |
Description : | Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al. |
Form : | Liquid |
Molecular Mass : | 37.070kDa inclusive of tags |
AA Sequence : | MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | LMX1A LIM homeobox transcription factor 1, alpha [ Homo sapiens ] |
Official Symbol | LMX1A |
Synonyms | LMX1A; LIM homeobox transcription factor 1, alpha; LMX1; LIM homeobox transcription factor 1-alpha; LMX1.1 |
Gene ID | 4009 |
mRNA Refseq | NM_001174069 |
Protein Refseq | NP_001167540 |
MIM | 600298 |
UniProt ID | Q8TE12 |
◆ Recombinant Proteins | ||
LMX1A-29601TH | Recombinant Human LMX1A | +Inquiry |
LMX1A-3120Z | Recombinant Zebrafish LMX1A | +Inquiry |
LMX1A-291HF | Recombinant Full Length Human LMX1A Protein | +Inquiry |
LMX1A-4635C | Recombinant Chicken LMX1A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LMX1A Products
Required fields are marked with *
My Review for All LMX1A Products
Required fields are marked with *