Recombinant Full Length Human LMX1A Protein

• Cat.No.: LMX1A-291HF
• Product Overview: Recombinant full length Human LMX1A (aa 1-100) with N-terminal proprietary tag, 37.07 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 100 amino acids
• Description: Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al.
• Form: Liquid
• Molecular Mass: 37.070kDa inclusive of tags
• AA Sequence: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: LMX1A LIM homeobox transcription factor 1, alpha [ Homo sapiens ]
• Official Symbol: LMX1A
• Synonyms: LMX1A; LIM homeobox transcription factor 1, alpha; LMX1; LIM homeobox transcription factor 1-alpha; LMX1.1
• Gene ID: 4009
• mRNA Refseq: NM_001174069
• Protein Refseq: NP_001167540
• MIM: 600298
• UniProt ID: Q8TE12