Recombinant Human LMX1A

Cat.No. : LMX1A-29601TH
Product Overview : Recombinant full length Human LMX1A (aa 1-100) with N-terminal proprietary tag, 37.07 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al.
Molecular Weight : 37.070kDa inclusive of tags
Tissue specificity : Isoform 1 is expressed in many tissues. Not found in heart, liver, spleen and testis. Relatively highly expressed in fetal brain. Isoform LMX1A-4B is expressed in testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
Sequence Similarities : Contains 1 homeobox DNA-binding domain.Contains 2 LIM zinc-binding domains.
Gene Name LMX1A LIM homeobox transcription factor 1, alpha [ Homo sapiens ]
Official Symbol LMX1A
Synonyms LMX1A; LIM homeobox transcription factor 1, alpha; LMX1; LIM homeobox transcription factor 1-alpha; LMX1.1;
Gene ID 4009
mRNA Refseq NM_001174069
Protein Refseq NP_001167540
MIM 600298
Uniprot ID Q8TE12
Chromosome Location 1q24.1
Function metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LMX1A Products

Required fields are marked with *

My Review for All LMX1A Products

Required fields are marked with *

0
cart-icon