Recombinant Human LMX1A

• Cat.No.: LMX1A-29601TH
• Product Overview: Recombinant full length Human LMX1A (aa 1-100) with N-terminal proprietary tag, 37.07 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al.
• Molecular Weight: 37.070kDa inclusive of tags
• Tissue specificity: Isoform 1 is expressed in many tissues. Not found in heart, liver, spleen and testis. Relatively highly expressed in fetal brain. Isoform LMX1A-4B is expressed in testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS
• Sequence Similarities: Contains 1 homeobox DNA-binding domain.Contains 2 LIM zinc-binding domains.

Gene Information

• Gene Name: LMX1A LIM homeobox transcription factor 1, alpha [ Homo sapiens ]
• Official Symbol: LMX1A
• Synonyms: LMX1A; LIM homeobox transcription factor 1, alpha; LMX1; LIM homeobox transcription factor 1-alpha; LMX1.1
• Gene ID: 4009
• mRNA Refseq: NM_001174069
• Protein Refseq: NP_001167540
• MIM: 600298
• Uniprot ID: Q8TE12
• Chromosome Location: 1q24.1
• Function: metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding