Recombinant Full Length Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Ii-A(Fcgr2A) Protein, His-Tagged
Cat.No. : | RFL9733HF |
Product Overview : | Recombinant Full Length Human Low affinity immunoglobulin gamma Fc region receptor II-a(FCGR2A) Protein (P12318) (34-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (34-317) |
Form : | Lyophilized powder |
AA Sequence : | QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FCGR2A |
Synonyms | FCGR2A; CD32; FCG2; FCGR2A1; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a; Fc-gamma-RIIa; FcRII-a; CD antigen CD32 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-260H | Active Recombinant Human FCGR2A Protein, His-tagged, Biotinylated | +Inquiry |
FCGR2A-4676H | Recombinant Human FCGR2A protein, His-tagged | +Inquiry |
FCGR2A-2963H | Active Recombinant Human FCGR2A, His & AVI Tagged, Biotinylated, 167 His | +Inquiry |
FCGR2A-1136H | Recombinant Human FCGR2A, His & AVI tagged | +Inquiry |
FCGR2A-333H | Recombinant Human FCGR2A protein, His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FCGR2A-03H | Active Recombinant Human FCGR2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *