Recombinant Full Length Human LPHN1 Protein, GST-tagged
Cat.No. : | LPHN1-5990HF |
Product Overview : | Human LPHN1 full-length ORF ( AAH19928, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms |
Molecular Mass : | 47.85 kDa |
AA Sequence : | MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LPHN1 latrophilin 1 [ Homo sapiens ] |
Official Symbol | LPHN1 |
Synonyms | LPHN1; latrophilin 1; latrophilin-1; CIRL1; KIAA0821; LEC2; CIRL-1; lectomedin-2; calcium-independent alpha-latrotoxin receptor 1; CL1; |
Gene ID | 22859 |
mRNA Refseq | NM_001008701 |
Protein Refseq | NP_001008701 |
MIM | 616416 |
UniProt ID | O94910 |
◆ Recombinant Proteins | ||
LPHN1-5990HF | Recombinant Full Length Human LPHN1 Protein, GST-tagged | +Inquiry |
LPHN1-4719H | Recombinant Human LPHN1 Protein, GST-tagged | +Inquiry |
LPHN1-4720H | Recombinant Human LPHN1 Protein | +Inquiry |
LPHN1-625H | Recombinant Human LPHN1, GST-tagged | +Inquiry |
LPHN1-5140M | Recombinant Mouse LPHN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPHN1-1029HCL | Recombinant Human LPHN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPHN1 Products
Required fields are marked with *
My Review for All LPHN1 Products
Required fields are marked with *
0
Inquiry Basket