Recombinant Full Length Human LPHN1 Protein, GST-tagged

Cat.No. : LPHN1-5990HF
Product Overview : Human LPHN1 full-length ORF ( AAH19928, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 201 amino acids
Description : This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Latrophilin-1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms
Molecular Mass : 47.85 kDa
AA Sequence : MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LPHN1 latrophilin 1 [ Homo sapiens ]
Official Symbol LPHN1
Synonyms LPHN1; latrophilin 1; latrophilin-1; CIRL1; KIAA0821; LEC2; CIRL-1; lectomedin-2; calcium-independent alpha-latrotoxin receptor 1; CL1;
Gene ID 22859
mRNA Refseq NM_001008701
Protein Refseq NP_001008701
MIM 616416
UniProt ID O94910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LPHN1 Products

Required fields are marked with *

My Review for All LPHN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon