Recombinant Full Length Human LPXN Protein, GST-tagged
| Cat.No. : | LPXN-6000HF |
| Product Overview : | Human LPXN full-length ORF ( AAH19035, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 386 amino acids |
| Description : | The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by, tyrosine kinase activity. Alternative splicing results in multiple transcript variants encoding distinct isoforms |
| Molecular Mass : | 68.20 kDa |
| AA Sequence : | MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LPXN leupaxin [ Homo sapiens ] |
| Official Symbol | LPXN |
| Synonyms | LPXN; leupaxin; LDPL; |
| Gene ID | 9404 |
| mRNA Refseq | NM_001143995 |
| Protein Refseq | NP_001137467 |
| MIM | 605390 |
| UniProt ID | O60711 |
| ◆ Recombinant Proteins | ||
| LPXN-4712H | Recombinant Human LPXN Protein, GST-tagged | +Inquiry |
| Lpxn-7898M | Recombinant Mouse Lpxn protein, His & T7-tagged | +Inquiry |
| LPXN-5145M | Recombinant Mouse LPXN Protein, His (Fc)-Avi-tagged | +Inquiry |
| LPXN-9208M | Recombinant Mouse LPXN Protein | +Inquiry |
| LPXN-6000HF | Recombinant Full Length Human LPXN Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LPXN-4661HCL | Recombinant Human LPXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPXN Products
Required fields are marked with *
My Review for All LPXN Products
Required fields are marked with *
