Recombinant Full Length Human LRG1 Protein, C-Flag-tagged
Cat.No. : | LRG1-297HFL |
Product Overview : | Recombinant Full Length Human LRG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADT VHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASA TLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRG PLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLW ASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | LRG1 leucine rich alpha-2-glycoprotein 1 [ Homo sapiens (human) ] |
Official Symbol | LRG1 |
Synonyms | LRG; HMFT1766 |
Gene ID | 116844 |
mRNA Refseq | NM_052972.3 |
Protein Refseq | NP_443204.1 |
MIM | 611289 |
UniProt ID | P02750 |
◆ Recombinant Proteins | ||
Lrg1-7854M | Recombinant Mouse Lrg1 protein, His-tagged | +Inquiry |
LRG1-1315H | Recombinant Human LRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRG1-54H | Recombinant Human LRG1 protein, T7/His-tagged | +Inquiry |
Lrg1-1987R | Recombinant Rat Lrg1 protein, His & GST-tagged | +Inquiry |
LRG1-142H | Recombinant Human LRG1, Fc tagged | +Inquiry |
◆ Native Proteins | ||
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
LRG1-3684H | Native Human LRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRG1-791HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
LRG1-755HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRG1 Products
Required fields are marked with *
My Review for All LRG1 Products
Required fields are marked with *