Recombinant Full Length Human LRRC10 Protein, GST-tagged
Cat.No. : | LRRC10-6027HF |
Product Overview : | Human LRRC10 full-length ORF ( NP_963844.2, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 277 amino acids |
Description : | LRRC10 (Leucine Rich Repeat Containing 10) is a Protein Coding gene. Diseases associated with LRRC10 include Dilated Cardiomyopathy. GO annotations related to this gene include actin binding and alpha-actinin binding. An important paralog of this gene is LRRC10B. |
Molecular Mass : | 58 kDa |
AA Sequence : | MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC10 leucine rich repeat containing 10 [ Homo sapiens ] |
Official Symbol | LRRC10 |
Synonyms | LRRC10; leucine rich repeat containing 10; leucine-rich repeat-containing protein 10; HRLRRP; LRRC10A; MGC125812; |
Gene ID | 376132 |
mRNA Refseq | NM_201550 |
Protein Refseq | NP_963844 |
MIM | 610846 |
UniProt ID | Q5BKY1 |
◆ Recombinant Proteins | ||
LRRC10-1949Z | Recombinant Zebrafish LRRC10 | +Inquiry |
Lrrc10-3822M | Recombinant Mouse Lrrc10 Protein, Myc/DDK-tagged | +Inquiry |
LRRC10-4686H | Recombinant Human LRRC10 Protein, GST-tagged | +Inquiry |
LRRC10-194H | Recombinant Human LRRC10 protein, His-tagged | +Inquiry |
LRRC10-6027HF | Recombinant Full Length Human LRRC10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC10-4650HCL | Recombinant Human LRRC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC10 Products
Required fields are marked with *
My Review for All LRRC10 Products
Required fields are marked with *
0
Inquiry Basket