Recombinant Human LRRC10 Protein, GST-tagged

Cat.No. : LRRC10-4686H
Product Overview : Human LRRC10 full-length ORF ( NP_963844.2, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LRRC10 (Leucine Rich Repeat Containing 10) is a Protein Coding gene. Diseases associated with LRRC10 include Dilated Cardiomyopathy. GO annotations related to this gene include actin binding and alpha-actinin binding. An important paralog of this gene is LRRC10B.
Molecular Mass : 58 kDa
AA Sequence : MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC10 leucine rich repeat containing 10 [ Homo sapiens ]
Official Symbol LRRC10
Synonyms LRRC10; leucine rich repeat containing 10; leucine-rich repeat-containing protein 10; HRLRRP; LRRC10A; MGC125812;
Gene ID 376132
mRNA Refseq NM_201550
Protein Refseq NP_963844
MIM 610846
UniProt ID Q5BKY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRC10 Products

Required fields are marked with *

My Review for All LRRC10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon